Web stats for Rishikeshraftingcampingadventures - rishikeshraftingcampingadventures.com
NO1 TRAVEL in RISHIKESH CAR RENT & HOTEL BOOKING SERVICES RISHIKESH & HARIDWAR ALL UTTARAKHAND CALL NOW 919456314753
1.67 Rating by ClearWebStats
This website is a sub-domain of com. This website has a #1,310,689 rank in global traffic. This domain is estimated value of $ 480.00 and has a daily earning of $ 2.00. While no active threats were reported recently by users, rishikeshraftingcampingadventures.com is SAFE to browse.
Traffic Report of Rishikeshraftingcampingadventures
Daily Unique Visitors: | 367 |
Daily Pageviews: | 734 |
Estimated Valuation
Income Per Day: | $ 2.00 |
Estimated Worth: | $ 480.00 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Yahoo Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Alexa BackLinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Privacy: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Google Pagerank: | Not Applicable |
Alexa Rank: | 1,310,689 |
Domain Authority: | Not Applicable |
Google Pagerank
PR 0 out of 10
PageSpeed Score
55
Siteadvisor Rating
Not Applicable
Where is rishikeshraftingcampingadventures.com server located?
Social Engagement
Facebook Shares: | Not Applicable |
Facebook Likes: | Not Applicable |
Facebook Comments: | Not Applicable |
Twitter Count (Tweets): | Not Applicable |
Linkedin Shares: | Not Applicable |
Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 1 | H2 Headings: | 19 |
H3 Headings: | 10 | H4 Headings: | 4 |
H5 Headings: | 1 | H6 Headings: | 2 |
Total IFRAMEs: | Not Applicable | Total Images: | 47 |
Google Adsense: | Not Applicable | Google Analytics: | UA-65420763-9 |
Websites Hosted on Same IP (i.e. 166.62.28.131)
HTTP Header Analysis
Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 10 Nov 2016 19:31:47 GMT
Server: Apache/2.4.23
X-Powered-By: PHP/5.4.45
Link: ; rel="https://api.w.org/", ; rel=shortlink
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Cache-Control: max-age=2592000
Expires: Sat, 10 Dec 2016 19:31:47 GMT
Connection: keep-alive
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
Status-Code: 200
Status: 200 OK
Date: Thu, 10 Nov 2016 19:31:47 GMT
Server: Apache/2.4.23
X-Powered-By: PHP/5.4.45
Link:
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Cache-Control: max-age=2592000
Expires: Sat, 10 Dec 2016 19:31:47 GMT
Connection: keep-alive
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
rishikeshraftingcampingadventures.com | A | 600 |
IP:166.62.28.131 |
rishikeshraftingcampingadventures.com | NS | 3600 |
Target:pdns07.domaincontrol.com |
rishikeshraftingcampingadventures.com | NS | 3600 |
Target:pdns08.domaincontrol.com |
rishikeshraftingcampingadventures.com | SOA | 600 |
MNAME:pdns07.domaincontrol.com RNAME:dns.jomax.net Serial:2016101302 Refresh:28800 Retry:7200 Expire:604800 |
rishikeshraftingcampingadventures.com | MX | 3600 |
Target:mail.rishikeshraftingcampingadventures.com |
rishikeshraftingcampingadventures.com | TXT | 3600 |
TXT:v=spf1 a mx ptr include:secureserver.net ~all |
Similarly Ranked Websites to Rishikeshraftingcampingadventures
Serious About Your Music
- projectmusic.net
A first class selection of premium quality guitars and accessories. From our highly regarded workshop and showroom we cater to customers all over the world.